PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10028250
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family MYB
Protein Properties Length: 408aa    MW: 43506.5 Da    PI: 6.3211
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10028250genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.94.2e-1765110147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +g+W++eEd  l ++v ++G ++W++Iar ++ gR++k+c++rw + 
      Lus10028250  65 KGPWSPEEDGVLSQLVSKFGARNWSLIARGIP-GRSGKSCRLRWCNQ 110
                      79******************************.***********985 PP

2Myb_DNA-binding55.11.7e-17117161147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      r+++T eEd++++ a++ +G++ W+ I+r ++ gRt++ +k++w++ 
      Lus10028250 117 RKPFTDEEDQIIISAHAVHGNK-WAVISRLLP-GRTDNAIKNHWNST 161
                      789*******************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129419.09160111IPR017930Myb domain
SuperFamilySSF466891.35E-3062158IPR009057Homeodomain-like
SMARTSM007171.1E-1364113IPR001005SANT/Myb domain
PfamPF002494.3E-1665110IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.1E-2666118IPR009057Homeodomain-like
CDDcd001671.76E-1367109No hitNo description
PROSITE profilePS5129425.302112166IPR017930Myb domain
SMARTSM007171.9E-16116164IPR001005SANT/Myb domain
PfamPF002494.5E-15117161IPR001005SANT/Myb domain
CDDcd001672.68E-12119162No hitNo description
Gene3DG3DSA:1.10.10.604.7E-24119165IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 408 aa     Download sequence    Send to blast
MGSLDGFDEA MREAANTEEE EDEGTAGDLT ESPTGGCGGD SSELGGVSGG GGNGSGGGVV  60
NSRVKGPWSP EEDGVLSQLV SKFGARNWSL IARGIPGRSG KSCRLRWCNQ LDPGLKRKPF  120
TDEEDQIIIS AHAVHGNKWA VISRLLPGRT DNAIKNHWNS TLRRRNTKLP RGNKHASSIG  180
MMIQNRNYDR RNTPPEEETP SNIDGGNSVK SVEEIRYIVT TPKEQPTTVP RPVARVSAFS  240
VYVPPGGGLK SGSIGSRQAL TQEPLVKASK PDFGICKLLE DIRSEPIVPS TCGFGCCSTP  300
SGGGHSRSSL LGPEFVDYEE QPCFSSQELI SIATDLNNIA WIKSGLENST SSGELSGCHG  360
IIHQGPQFSV SQMGMPEQNR SKFVGTMTEA LPNHKSLAMR AEVESLS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-39641656107B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012088150.11e-129PREDICTED: uncharacterized protein LOC105646817
TrEMBLA0A067LKI81e-129A0A067LKI8_JATCU; MYB family protein
STRINGVIT_13s0019g03200.t011e-115(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF39863362
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G55730.11e-93myb domain protein 109